001/*
002 *                    BioJava development code
003 *
004 * This code may be freely distributed and modified under the
005 * terms of the GNU Lesser General Public Licence.  This should
006 * be distributed with the code.  If you do not have a copy,
007 * see:
008 *
009 *      http://www.gnu.org/copyleft/lesser.html
010 *
011 * Copyright for this code is held jointly by the individual
012 * authors.  These should be listed in @author doc comments.
013 *
014 * For more information on the BioJava project and its aims,
015 * or to join the biojava-l mailing list, visit the home page
016 * at:
017 *
018 *      http://www.biojava.org/
019 *
020 */
021package demo;
022
023import org.biojava.nbio.structure.ResidueNumber;
024import org.biojava.nbio.structure.Structure;
025import org.biojava.nbio.structure.StructureException;
026import org.biojava.nbio.structure.align.util.AtomCache;
027import org.biojava.nbio.structure.gui.BiojavaJmol;
028import org.biojava.nbio.structure.io.FastaStructureParser;
029import org.biojava.nbio.core.sequence.ProteinSequence;
030import org.biojava.nbio.core.sequence.compound.AminoAcidCompound;
031import org.biojava.nbio.core.sequence.compound.AminoAcidCompoundSet;
032import org.biojava.nbio.core.sequence.io.GenericFastaHeaderParser;
033import org.biojava.nbio.core.sequence.io.ProteinSequenceCreator;
034import org.biojava.nbio.core.sequence.io.template.SequenceCreatorInterface;
035import org.biojava.nbio.core.sequence.io.template.SequenceHeaderParserInterface;
036
037import java.io.ByteArrayInputStream;
038import java.io.IOException;
039import java.io.InputStream;
040import java.io.UnsupportedEncodingException;
041
042/**
043 * Demo of how to use the {@link FastaStructureParser} class to read protein
044 * structures from a FASTA file.
045 *
046 * @author Spencer Bliven
047 *
048 */
049public class DemoStructureFromFasta {
050
051        @SuppressWarnings("unused")
052        public static void getStructureFromFasta() {
053
054                // Load a test sequence
055                // Normally this would come from a file, eg
056                // File fasta = new File("/path/to/file.fa");
057                String fastaStr =
058                        "> 4HHB\n" +
059                        "VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGK\n" +
060                        "KVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPA\n" +
061                        "VHASLDKFLASVSTVLTSKYR\n";
062                InputStream fasta;
063                try {
064                        fasta = new ByteArrayInputStream(fastaStr.getBytes("UTF-8"));
065                } catch (UnsupportedEncodingException e) {
066                        e.printStackTrace();
067                        return;
068                }
069
070                // Create a header parser to parse the header lines into valid structure accessions.
071                // The resulting accession can be anything interpretable by AtomCache.getStructure.
072                // Possible Examples: "4HHB" (whole structure), "d4hhba_" (SCOP domain),
073                //   "4HHB.A:1-15" (residue range)
074                // For this example, the built-in fasta parser will extract the correct accession.
075                SequenceHeaderParserInterface<ProteinSequence, AminoAcidCompound> headerParser;
076                headerParser = new GenericFastaHeaderParser<>();
077
078                // Create AtomCache to fetch structures from the PDB
079                AtomCache cache = new AtomCache();
080
081                // Create SequenceCreator. This converts a String to a ProteinSequence
082                AminoAcidCompoundSet aaSet = AminoAcidCompoundSet.getAminoAcidCompoundSet();
083                SequenceCreatorInterface<AminoAcidCompound> creator;
084                creator = new ProteinSequenceCreator(aaSet);
085
086                // parse file
087                FastaStructureParser parser = new FastaStructureParser(
088                                fasta, headerParser, creator, cache);
089                try {
090                        parser.process();
091                } catch (IOException e) {
092                        e.printStackTrace();
093                        return;
094                } catch (StructureException e) {
095                        e.printStackTrace();
096                        return;
097                }
098
099                // Get info from the parser
100                ResidueNumber[][] residues = parser.getResidues();
101                ProteinSequence[] sequences = parser.getSequences();
102                Structure[] structures = parser.getStructures();
103                String[] accessions = parser.getAccessions();
104
105                // Use it! For example:
106                // Display the structure, highlighting the sequence
107                displayStructure( structures[0], residues[0]);
108        }
109
110
111        /**
112         * Displays the given structure and highlights the given residues.
113         *
114         * @param structure The structure to display
115         * @param residues A list of residues to highlight
116         */
117        private static void displayStructure(Structure structure,
118                        ResidueNumber[] residues) {
119                //Display each structure
120                BiojavaJmol jmol = new BiojavaJmol();
121                jmol.setStructure(structure);
122
123                //Highlight non-null atoms
124                jmol.evalString("select *; spacefill off; wireframe off; color chain; backbone 0.4;  ");
125                String selectionCmd = buildJmolSelection(residues);
126                jmol.evalString(selectionCmd);
127                jmol.evalString("backbone 1.0; select none;");
128        }
129
130
131
132        /**
133         * Converts an array of ResidueNumbers into a jMol selection.
134         *
135         * <p>For example, "select 11^ :A.CA or 12^ :A.CA;" would select the
136         * CA atoms of residues 11-12 on chain A.
137         * @param residues Residues to include in the selection. Nulls are ignored.
138         * @return
139         */
140        private static String buildJmolSelection(ResidueNumber[] residues) {
141                StringBuilder cmd = new StringBuilder("select ");
142                for(ResidueNumber res : residues) {
143                        if(res != null) {
144                                cmd.append(String.format("%d^%s:%s.CA or ", res.getSeqNum(),
145                                                res.getInsCode()==null?" ":res.getInsCode(),
146                                                                res.getChainName()));
147                        }
148                }
149                cmd.append("none;");//easier than removing the railing 'or'
150                return cmd.toString();
151        }
152
153
154
155        public static void main(String[] args) {
156                getStructureFromFasta();
157        }
158}