BioJava:CookBook3:NCBIQBlastService
How can I use NCBIQBlastService to do my alignments remotely?
BioJava now has some ability to use remote bioinformatics services to execute tasks on servers and fetch the results for further use. The first example of this new ability is the capacity to perform Blast analysis via the Blast URLAPI (formerly known as QBlast) service at NCBI. Not strictly speaking a web service in the true sense of the word, Blast URLAPI protocol uses specially formatted HTTP requests to execute Blast searches on NCBI servers.
The QBlast BioJava classes implement a serie of interfaces: RemotePairwiseAlignmentService, RemotePairwiseAlignmentProperties and RemotePairwiseAlignmentOutputProperties. These interfaces are designed in such a fashion that setting the parameters for alignement, submitting the results and fetching the results in a desired format are done independently from each other. This allows a program to send a bunch of requests, grab the requests ID and fetch the results at a later time. These interfaces (found in package org.biojava3.ws.alignment) should allow extensions to other remote alignment services like FASTA and Blast at EBI, which use classic web services.
To use Blast via URLAPI, use a NCBIQBlastService object (which implements RemotePairwiseAlignmentService) to manage the connection to the NCBI Blast service, submission of requests and fetching of results. To send Blast request to NCBI servers, it needs a sequence (represented by either a string or a Sequence object) or GID and a NCBIQBlastAlignmentProperties object. Submitting a Sequence object is the preferred method since it allows for some basic sanity checks related to the sequence type-to-program selection. The NCBIQBlastAlignmentProperties class (which implements RemotePairwiseAlignmentProperties) is used to set search request parameters. Most often used parameters have wrapper methods, e.g. setBlastProgram(BlastProgramEnum program), other options should be set using setAlignmentOption(BlastAlignmentParameterEnum, String) method. After sending the request NCBIQBlastService returns request ID (RID), which is used to fetch the results later. To recover Blast results later simply pass RID along with NCBIQBlastOutputProperties object to NCBIQBlastService. Similarly to alignment options, output parameters are set by using NCBIQBlastOutputProperties wrapper methods or its setOutputOption(BlastOutputParameterEnum, String) method.
Description of Blast URLAPI and its parameters can be found at 1.
WARNING (as of February 2012):
-
You need to use the latest biojava-live tree to have this example working.
-
Do not use multiple threads to send loads of requests to NCBI. This would only get you into trouble, up to getting you blacklisted by NCBI.
The following sample program is slightly modified demo program from biojava3-ws module’s demo package:
```java import static org.biojava.nbio.ws.alignment.qblast.BlastAlignmentParameterEnum.ENTREZ_QUERY; import java.io.*; import org.biojava.nbio.core.sequence.io.util.IOUtils; import org.biojava.nbio.ws.alignment.qblast.*;
public class NCBIQBlastServiceDemo {
private static final String BLAST_OUTPUT_FILE = "blastOutput.xml"; // file to save blast results to
private static final String SEQUENCE = "MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCP"; // Blast query sequence
public static void main(String[] args) {
NCBIQBlastService service = new NCBIQBlastService();
// set alignment options
NCBIQBlastAlignmentProperties props = new NCBIQBlastAlignmentProperties();
props.setBlastProgram(BlastProgramEnum.blastp);
props.setBlastDatabase("swissprot");
props.setAlignmentOption(ENTREZ_QUERY, "\"serum albumin\"[Protein name] AND mammals[Organism]");
// set output options
NCBIQBlastOutputProperties outputProps = new NCBIQBlastOutputProperties();
// in this example we use default values set by constructor (XML format, pairwise alignment, 100 descriptions and alignments)
// Example of two possible ways of setting output options
// outputProps.setAlignmentNumber(200); // outputProps.setOutputOption(BlastOutputParameterEnum.ALIGNMENTS, “200”);
String rid = null; // blast request ID
FileWriter writer = null;
BufferedReader reader = null;
try {
// send blast request and save request id
rid = service.sendAlignmentRequest(SEQUENCE, props);
// wait until results become available. Alternatively, one can do other computations/send other alignment requests
while (!service.isReady(rid)) {
System.out.println("Waiting for results. Sleeping for 5 seconds");
Thread.sleep(5000);
}
// read results when they are ready
InputStream in = service.getAlignmentResults(rid, outputProps);
reader = new BufferedReader(new InputStreamReader(in));
// write blast output to specified file
File f = new File(BLAST_OUTPUT_FILE);
System.out.println("Saving query results in file " + f.getAbsolutePath());
writer = new FileWriter(f);
String line;
while ((line = reader.readLine()) != null) {
writer.write(line + System.getProperty("line.separator"));
}
} catch (Exception e) {
System.out.println(e.getMessage());
e.printStackTrace();
} finally {
// clean up
IOUtils.close(writer);
IOUtils.close(reader);
// delete given alignment results from blast server (optional operation)
service.sendDeleteRequest(rid);
}
}
} ```